PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G10480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 199aa    MW: 22091.6 Da    PI: 10.3555
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G10480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.31.5e-112057643
                     HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                     k  r   fskR ++i+ KA+EL +LC++ va   +s++
  OPUNC03G10480.1 20 KKVRDACFSKRHTTIFNKANELAILCGVMVAAAFVSPN 57
                     6678999***********************99888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.3E-10868IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.32857IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-14883IPR002100Transcription factor, MADS-box
CDDcd002661.53E-15982No hitNo description
PfamPF003194.8E-131965IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MVKCRARMTR KKIEIKRGDK KVRDACFSKR HTTIFNKANE LAILCGVMVA AAFVSPNANG  60
GIFSFGYPSV SSVANRFLAN HAPNSTSVSS STQSGRDVEI RELEREEREL KEHLQASKNK  120
NKLLQKAIAA RDGGQLMLHL QSDCSELGPK GLVGFGNLLM KSLVIYYVHG DLTYPIFKPM  180
MHAGEAESRS ELKMAYAKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2318010.0AC231801.1 Oryza minuta clone OM__Ba0163M10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651224.12e-67PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLA0A0E0KBE21e-147A0A0E0KBE2_ORYPU; Uncharacterized protein
STRINGLOC_Os03g14850.16e-86(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2042088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.19e-12AGAMOUS-like 29